Lineage for d1cbxa_ (1cbx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889495Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2889496Protein Carboxypeptidase A [53189] (4 species)
  7. 2889499Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. 2889546Domain d1cbxa_: 1cbx A: [33813]
    complexed with bzs, zn

Details for d1cbxa_

PDB Entry: 1cbx (more details), 2 Å

PDB Description: crystal structure of the complex between carboxypeptidase a and the biproduct analog inhibitor l-benzylsuccinate at 2.0 angstroms resolution
PDB Compounds: (A:) carboxypeptidase a

SCOPe Domain Sequences for d1cbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbxa_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOPe Domain Coordinates for d1cbxa_:

Click to download the PDB-style file with coordinates for d1cbxa_.
(The format of our PDB-style files is described here.)

Timeline for d1cbxa_: