Lineage for d1arla_ (1arl A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1861985Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1861986Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 1861987Protein Carboxypeptidase A [53189] (4 species)
  7. 1861990Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. 1862018Domain d1arla_: 1arl A: [33812]

Details for d1arla_

PDB Entry: 1arl (more details), 1.88 Å

PDB Description: carboxypeptidase a with zn removed
PDB Compounds: (A:) apo-carboxypeptidase a=alpha= (cox)

SCOPe Domain Sequences for d1arla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arla_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOPe Domain Coordinates for d1arla_:

Click to download the PDB-style file with coordinates for d1arla_.
(The format of our PDB-style files is described here.)

Timeline for d1arla_: