Lineage for d1arl__ (1arl -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins) Protein Carboxypeptidase A [53189] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53190] (17 PDB entries) 
Domain d1arl__: 1arl - [33812]
Details for d1arl__
PDB Entry: 1arl (more details), 1.86 Å
PDB Description: carboxypeptidase a with zn removed
SCOP Domain Sequences for d1arl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1arl__ c.56.5.1 (-) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn
SCOP Domain Coordinates for d1arl__:
Click to download the PDB-style file with coordinates for d1arl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1arl__:
- d1arl__ first appeared (with stable ids) in SCOP 1.55
- d1arl__ appears in SCOP 1.59
- d1arl__ appears in the current release, SCOPe 2.08, called d1arla_
View in 3D