![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5x8ll2: 5x8l L:107-211 [338113] Other proteins in same PDB: d5x8la_, d5x8lb_, d5x8lc_, d5x8ld_, d5x8le_, d5x8lf_, d5x8lg_, d5x8lh_, d5x8lj_, d5x8lk1, d5x8ll1, d5x8lm1, d5x8ln1, d5x8lo1, d5x8ls_ automated match to d1dn0a2 |
PDB Entry: 5x8l (more details), 3.1 Å
SCOPe Domain Sequences for d5x8ll2:
Sequence, based on SEQRES records: (download)
>d5x8ll2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
>d5x8ll2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwnsqesvteqdskdstysl sstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d5x8ll2: