Lineage for d5wofb1 (5wof B:1-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944700Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2944701Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2944702Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2944751Protein automated matches [190350] (4 species)
    not a true protein
  7. 2944757Species Plasmodium falciparum [TaxId:36329] [188146] (1 PDB entry)
  8. 2944759Domain d5wofb1: 5wof B:1-83 [338110]
    Other proteins in same PDB: d5wofa2, d5wofb2, d5wofc2
    automated match to d1f95a_

Details for d5wofb1

PDB Entry: 5wof (more details), 1.65 Å

PDB Description: 1.65 angstrom structure of the dynein light chain 1 from plasmodium falciparum
PDB Compounds: (B:) Dynein light chain 1, putative

SCOPe Domain Sequences for d5wofb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wofb1 d.39.1.1 (B:1-83) automated matches {Plasmodium falciparum [TaxId: 36329]}
vvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgsyv
thetknfiyfyigqvaillfksg

SCOPe Domain Coordinates for d5wofb1:

Click to download the PDB-style file with coordinates for d5wofb1.
(The format of our PDB-style files is described here.)

Timeline for d5wofb1: