Lineage for d5x8ln2 (5x8l N:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752270Domain d5x8ln2: 5x8l N:107-213 [338107]
    Other proteins in same PDB: d5x8la_, d5x8lb_, d5x8lc_, d5x8ld_, d5x8le_, d5x8lf_, d5x8lg_, d5x8lh_, d5x8lj_, d5x8lk1, d5x8ll1, d5x8lm1, d5x8ln1, d5x8lo1, d5x8ls_
    automated match to d1dn0a2

Details for d5x8ln2

PDB Entry: 5x8l (more details), 3.1 Å

PDB Description: pd-l1 in complex with atezolizumab
PDB Compounds: (N:) atezolizumab light chain

SCOPe Domain Sequences for d5x8ln2:

Sequence, based on SEQRES records: (download)

>d5x8ln2 b.1.1.2 (N:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Sequence, based on observed residues (ATOM records): (download)

>d5x8ln2 b.1.1.2 (N:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwnsqesvteqdskdstysl
sstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5x8ln2:

Click to download the PDB-style file with coordinates for d5x8ln2.
(The format of our PDB-style files is described here.)

Timeline for d5x8ln2: