Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5x8ma_: 5x8m A: [338095] Other proteins in same PDB: d5x8mb_, d5x8mc1, d5x8mc2 automated match to d3bova_ |
PDB Entry: 5x8m (more details), 2.66 Å
SCOPe Domain Sequences for d5x8ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x8ma_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aftvtvpkdlyvveygsnmtieckfpvekeldlaalivywemedkniiqfvhgeedlkvq hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnap
Timeline for d5x8ma_: