![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.2: Thermolysin-like [55490] (5 proteins) includes alpha-helical C-terminal domain characteristic for the family |
![]() | Protein Thermolysin [63414] (3 species) |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [279445] (12 PDB entries) |
![]() | Domain d5wr5a_: 5wr5 A: [338092] automated match to d1kkka_ complexed with ca, nx6, pg4, zn |
PDB Entry: 5wr5 (more details), 1.9 Å
SCOPe Domain Sequences for d5wr5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wr5a_ d.92.1.2 (A:) Thermolysin {Geobacillus stearothermophilus [TaxId: 1422]} itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts qevasvkqafdavgvk
Timeline for d5wr5a_: