SCOP 1.73: Domain d1bavd_: 1bav D:

Lineage for d1bavd_ (1bav D:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (27 PDB entries)

8. Domain d1bavd_: 1bav D: [33809]
   complexed with bip, zn

Details for d1bavd_

PDB Entry: 1bav, 1.6 Å

PDB Description: carboxypeptidase a complexed with 2-benzyl-3-iodo-propanoic acid (bip)

PDB Compounds: (D:) carboxypeptidase a

SCOP Domain Sequences for d1bavd_:

Sequence; same for both SEQRES and ATOM records:

>d1bavd_ c.56.5.1 (D:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

Timeline for d1bavd_:

• d1bavd_ first appeared (with stable ids) in SCOP 1.55
  
• d1bavd_ appears in SCOP 1.71
  
• d1bavd_ appears in SCOP 1.75
  
• d1bavd_ appears in the current release, SCOPe 2.08