| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [338037] (2 PDB entries) |
| Domain d5xg9d1: 5xg9 D:2-56 [338084] Other proteins in same PDB: d5xg9a2, d5xg9a3, d5xg9b2, d5xg9b3, d5xg9c2, d5xg9c3, d5xg9d2, d5xg9d3, d5xg9e2, d5xg9e3, d5xg9f2, d5xg9g2, d5xg9g3, d5xg9h2, d5xg9h3 automated match to d1awwa_ complexed with 1pe, peu, pg6, so4 |
PDB Entry: 5xg9 (more details), 1.78 Å
SCOPe Domain Sequences for d5xg9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xg9d1 b.34.2.0 (D:2-56) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
lpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkei
Timeline for d5xg9d1: