Lineage for d5xkma_ (5xkm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342579Species Human (Homo sapiens) [TaxId:9606] [188676] (116 PDB entries)
  8. 2342765Domain d5xkma_: 5xkm A: [338076]
    Other proteins in same PDB: d5xkmb2, d5xkmc2
    automated match to d4d09a_
    complexed with 87r, mg, zn

Details for d5xkma_

PDB Entry: 5xkm (more details), 2.16 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with 6- methyl-n-(1-(4-(trifluoromethoxy)phenyl)propyl)pyrazolo[1,5- a]pyrimidine-3-carboxamide
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5xkma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xkma_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldflde

SCOPe Domain Coordinates for d5xkma_:

Click to download the PDB-style file with coordinates for d5xkma_.
(The format of our PDB-style files is described here.)

Timeline for d5xkma_: