Lineage for d1bavb_ (1bav B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25553Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 25554Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 25555Protein Carboxypeptidase A [53189] (3 species)
  7. 25556Species Cow (Bos taurus) [TaxId:9913] [53190] (17 PDB entries)
  8. 25562Domain d1bavb_: 1bav B: [33807]

Details for d1bavb_

PDB Entry: 1bav (more details), 1.6 Å

PDB Description: carboxypeptidase a complexed with 2-benzyl-3-iodo-propanoic acid (bip)

SCOP Domain Sequences for d1bavb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bavb_ c.56.5.1 (B:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOP Domain Coordinates for d1bavb_:

Click to download the PDB-style file with coordinates for d1bavb_.
(The format of our PDB-style files is described here.)

Timeline for d1bavb_: