Lineage for d5wofa1 (5wof A:1-83)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551753Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2551754Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2551755Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2551804Protein automated matches [190350] (4 species)
    not a true protein
  7. 2551810Species Plasmodium falciparum [TaxId:36329] [188146] (1 PDB entry)
  8. 2551811Domain d5wofa1: 5wof A:1-83 [338069]
    Other proteins in same PDB: d5wofa2, d5wofb2, d5wofc2
    automated match to d1f95a_

Details for d5wofa1

PDB Entry: 5wof (more details), 1.65 Å

PDB Description: 1.65 angstrom structure of the dynein light chain 1 from plasmodium falciparum
PDB Compounds: (A:) Dynein light chain 1, putative

SCOPe Domain Sequences for d5wofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wofa1 d.39.1.1 (A:1-83) automated matches {Plasmodium falciparum [TaxId: 36329]}
vvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgsyv
thetknfiyfyigqvaillfksg

SCOPe Domain Coordinates for d5wofa1:

Click to download the PDB-style file with coordinates for d5wofa1.
(The format of our PDB-style files is described here.)

Timeline for d5wofa1: