Lineage for d5xggc1 (5xgg C:2-56)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783420Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [338037] (2 PDB entries)
  8. 2783423Domain d5xggc1: 5xgg C:2-56 [338057]
    Other proteins in same PDB: d5xgga2, d5xgga3, d5xggb2, d5xggb3, d5xggc2, d5xggc3, d5xggd2, d5xggd3, d5xgge2, d5xgge3, d5xggf2, d5xggf3
    automated match to d1awwa_
    complexed with so4

Details for d5xggc1

PDB Entry: 5xgg (more details), 1.72 Å

PDB Description: crystal structure c-terminal sh3 domain of myosin ib from entamoeba histolytica
PDB Compounds: (C:) Unconventional myosin IB

SCOPe Domain Sequences for d5xggc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xggc1 b.34.2.0 (C:2-56) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
lpqvkalypytaandeelsfkvgdiitilekdegwwkgelngqegwipnnyvkei

SCOPe Domain Coordinates for d5xggc1:

Click to download the PDB-style file with coordinates for d5xggc1.
(The format of our PDB-style files is described here.)

Timeline for d5xggc1: