Lineage for d1f57a_ (1f57 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins) Protein Carboxypeptidase A [53189] (3 species) Species Cow (Bos taurus) [TaxId:9913] [53190] (17 PDB entries) 
Domain d1f57a_: 1f57 A: [33805]
Details for d1f57a_
PDB Entry: 1f57 (more details), 1.75 Å
PDB Description: carboxypeptidase a complex with d-cysteine at 1.75 a
SCOP Domain Sequences for d1f57a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f57a_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn
SCOP Domain Coordinates for d1f57a_:
Click to download the PDB-style file with coordinates for d1f57a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f57a_:
- d1f57a_ appears in SCOP 1.57
- d1f57a_ appears in the current release, SCOPe 2.08
View in 3D