Lineage for d5wr2a_ (5wr2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963595Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2963611Protein Thermolysin [63414] (3 species)
  7. 2963805Species Geobacillus stearothermophilus [TaxId:1422] [279445] (12 PDB entries)
  8. 2963813Domain d5wr2a_: 5wr2 A: [338043]
    automated match to d1kkka_
    complexed with ca, nx6, zn

Details for d5wr2a_

PDB Entry: 5wr2 (more details), 2 Å

PDB Description: thermolysin, sfx liganded form with oil-based carrier
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d5wr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wr2a_ d.92.1.2 (A:) Thermolysin {Geobacillus stearothermophilus [TaxId: 1422]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d5wr2a_:

Click to download the PDB-style file with coordinates for d5wr2a_.
(The format of our PDB-style files is described here.)

Timeline for d5wr2a_: