SCOPe 2.06: Domain d1ymea_: 1yme A:

Lineage for d1ymea_ (1yme A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)

8. Domain d1ymea_: 1yme A: [33804]
   complexed with zn

Details for d1ymea_

PDB Entry: 1yme, 1.53 Å

PDB Description: structure of carboxypeptidase

PDB Compounds: (A:) carboxypeptidase a alpha

SCOPe Domain Sequences for d1ymea_:

Sequence; same for both SEQRES and ATOM records:

>d1ymea_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

Timeline for d1ymea_:

• d1ymea_ first appeared (with stable ids) in SCOP 1.55, called d1yme__
  
• d1ymea_ appears in SCOPe 2.05
  
• d1ymea_ appears in SCOPe 2.07
  
• d1ymea_ appears in the current release, SCOPe 2.08