Lineage for d1ymea_ (1yme A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703084Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)
  6. 703085Protein Carboxypeptidase A [53189] (4 species)
  7. 703088Species Cow (Bos taurus) [TaxId:9913] [53190] (27 PDB entries)
  8. 703092Domain d1ymea_: 1yme A: [33804]
    complexed with zn

Details for d1ymea_

PDB Entry: 1yme (more details), 1.53 Å

PDB Description: structure of carboxypeptidase
PDB Compounds: (A:) carboxypeptidase a alpha

SCOP Domain Sequences for d1ymea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymea_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOP Domain Coordinates for d1ymea_:

Click to download the PDB-style file with coordinates for d1ymea_.
(The format of our PDB-style files is described here.)

Timeline for d1ymea_: