Lineage for d5xeub_ (5xeu B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412735Fold b.157: Hcp1-like [141451] (1 superfamily)
    barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus
  4. 2412736Superfamily b.157.1: Hcp1-like [141452] (2 families) (S)
    probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets
  5. 2412743Family b.157.1.0: automated matches [191591] (1 protein)
    not a true family
  6. 2412744Protein automated matches [191065] (5 species)
    not a true protein
  7. 2412756Species Salmonella typhimurium [TaxId:90371] [338034] (2 PDB entries)
  8. 2412758Domain d5xeub_: 5xeu B: [338036]
    automated match to d4tv4a_

Details for d5xeub_

PDB Entry: 5xeu (more details), 3 Å

PDB Description: crystal structure of hcp2 from salmonella typhimurium
PDB Compounds: (B:) Hcp1 family type VI secretion system effector

SCOPe Domain Sequences for d5xeub_:

Sequence, based on SEQRES records: (download)

>d5xeub_ b.157.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ydiflkidgidgesmddkhkneievlswrwnihqestmhagsglgsgkvsvtnlsfehyi
draspnlfkycssgkhipqailvmrkaggnpleylkytftdliiamvspsgsqggeiasr
esielsfstvkqeyvvqnqqggsggtitagydfkanke

Sequence, based on observed residues (ATOM records): (download)

>d5xeub_ b.157.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ydiflkidgidgesmddkhkneievlswrwnihvsvtnlsfehyidraspnlfkycssgk
hipqailvmrkaeylkytftdliiamvspsgsqasresielsfstvkqeyvvqggtitag
ydfkanke

SCOPe Domain Coordinates for d5xeub_:

Click to download the PDB-style file with coordinates for d5xeub_.
(The format of our PDB-style files is described here.)

Timeline for d5xeub_: