![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.39: DLC [54647] (1 superfamily) core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342 |
![]() | Superfamily d.39.1: DLC [54648] (1 family) ![]() automatically mapped to Pfam PF01221 |
![]() | Family d.39.1.1: DLC [54649] (3 proteins) 8 kDa dynein light chain, DLC8 |
![]() | Protein automated matches [190350] (4 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [188146] (1 PDB entry) |
![]() | Domain d5wofc1: 5wof C:1-83 [338029] Other proteins in same PDB: d5wofa2, d5wofb2, d5wofc2 automated match to d1f95a_ |
PDB Entry: 5wof (more details), 1.65 Å
SCOPe Domain Sequences for d5wofc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wofc1 d.39.1.1 (C:1-83) automated matches {Plasmodium falciparum [TaxId: 36329]} vvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgsyv thetknfiyfyigqvaillfksg
Timeline for d5wofc1:
![]() Domains from other chains: (mouse over for more information) d5wofa1, d5wofa2, d5wofb1, d5wofb2 |