SCOPe 2.08: Domain d5wofc1: 5wof C:1-83

Lineage for d5wofc1 (5wof C:1-83)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)
   automatically mapped to Pfam PF01221

5. Family d.39.1.1: DLC [54649] (3 proteins)
   8 kDa dynein light chain, DLC8

6. Protein automated matches [190350] (4 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [188146] (1 PDB entry)

8. Domain d5wofc1: 5wof C:1-83 [338029]
   Other proteins in same PDB: d5wofa2, d5wofb2, d5wofc2
   automated match to d1f95a_

Details for d5wofc1

PDB Entry: 5wof, 1.65 Å

PDB Description: 1.65 angstrom structure of the dynein light chain 1 from plasmodium falciparum

PDB Compounds: (C:) Dynein light chain 1, putative

SCOPe Domain Sequences for d5wofc1:

Sequence; same for both SEQRES and ATOM records:

>d5wofc1 d.39.1.1 (C:1-83) automated matches {Plasmodium falciparum [TaxId: 36329]}
vvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgsyv
thetknfiyfyigqvaillfksg

Timeline for d5wofc1:

• d5wofc1 first appeared in SCOPe 2.06
  
• d5wofc1 appears in SCOPe 2.07