Lineage for d5we8b_ (5we8 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982857Protein Protein kinase wnk1 [111196] (2 species)
    OPK group; WNK subfamily; serine/threonine kinase
  7. 2982858Species Human (Homo sapiens) [TaxId:9606] [111197] (4 PDB entries)
    Uniprot Q9JIH7 211-480
  8. 2982861Domain d5we8b_: 5we8 B: [338023]
    automated match to d4pwna_
    complexed with a7y, anp, mn

Details for d5we8b_

PDB Entry: 5we8 (more details), 2.01 Å

PDB Description: crystal structure of wnk1 in complex with n-{(3r)-1-[(4-chlorophenyl) methyl]pyrrolidin-3-yl}-2-(3-methoxyphenyl)-n-methylquinoline-4- carboxamide (compound 8)
PDB Compounds: (B:) Serine/threonine-protein kinase WNK1

SCOPe Domain Sequences for d5we8b_:

Sequence, based on SEQRES records: (download)

>d5we8b_ d.144.1.7 (B:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}
letkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfk
eeaemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrs
wcrqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkradfaksvigt
pefmapemyaaaydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdk
vaipevkeiiegcirqnkderysikdllnhaffq

Sequence, based on observed residues (ATOM records): (download)

>d5we8b_ d.144.1.7 (B:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}
letkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfk
eeaemlkglqhpnivrfydswestvkgcivlvtelmtsgtlktylkrfkvmkikvlrswc
rqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkradfaksvigtpe
fmapemyaaaydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkva
ipevkeiiegcirqnkderysikdllnhaffq

SCOPe Domain Coordinates for d5we8b_:

Click to download the PDB-style file with coordinates for d5we8b_.
(The format of our PDB-style files is described here.)

Timeline for d5we8b_: