| Class b: All beta proteins [48724] (177 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
| Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
| Protein Fibroblast growth factor 9, FGF9 [63781] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63782] (3 PDB entries) |
| Domain d5w59a_: 5w59 A: [338022] Other proteins in same PDB: d5w59b1, d5w59b2 automated match to d1g82b_ complexed with so4 |
PDB Entry: 5w59 (more details), 2.5 Å
SCOPe Domain Sequences for d5w59a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w59a_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens) [TaxId: 9606]}
kgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgvdsglylg
mnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdgtpregtr
tkrhqkfthflprpvdpakvpelykd
Timeline for d5w59a_: