Lineage for d5w59a_ (5w59 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2384843Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2384844Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2385121Protein Fibroblast growth factor 9, FGF9 [63781] (1 species)
  7. 2385122Species Human (Homo sapiens) [TaxId:9606] [63782] (3 PDB entries)
  8. 2385128Domain d5w59a_: 5w59 A: [338022]
    Other proteins in same PDB: d5w59b1, d5w59b2
    automated match to d1g82b_
    complexed with so4

Details for d5w59a_

PDB Entry: 5w59 (more details), 2.5 Å

PDB Description: crystal structure of a monomeric human fgf9 in complex with the ectodomain of human fgfr1c
PDB Compounds: (A:) fibroblast growth factor 9

SCOPe Domain Sequences for d5w59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w59a_ b.42.1.1 (A:) Fibroblast growth factor 9, FGF9 {Human (Homo sapiens) [TaxId: 9606]}
kgilrrrqlycrtgfhleifpngtiqgtrkdhsrfgilefisiavglvsirgvdsglylg
mnekgelygsekltqecvfreqfeenwyntyssnlykhvdtgrryyvalnkdgtpregtr
tkrhqkfthflprpvdpakvpelykd

SCOPe Domain Coordinates for d5w59a_:

Click to download the PDB-style file with coordinates for d5w59a_.
(The format of our PDB-style files is described here.)

Timeline for d5w59a_: