SCOPe 2.06: Domain d5w59b2: 5w59 B:250-360

Lineage for d5w59b2 (5w59 B:250-360)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5w59b2: 5w59 B:250-360 [338019]
   Other proteins in same PDB: d5w59a_
   automated match to d3ojvc2
   complexed with so4

Details for d5w59b2

PDB Entry: 5w59, 2.5 Å

PDB Description: crystal structure of a monomeric human fgf9 in complex with the ectodomain of human fgfr1c

PDB Compounds: (B:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d5w59b2:

Sequence, based on SEQRES records:

>d5w59b2 b.1.1.0 (B:250-360) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrhrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvq
ilktagvnttdkemevlhlrnvsfedageytclagnsiglshhsawltvle

Sequence, based on observed residues (ATOM records):

>d5w59b2 b.1.1.0 (B:250-360) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrhrpilqaglpanktvalgsnvefmckvysdpqphiqwlkhievngslpyvqilktag
vnttdkemevlhlrnvsfedageytclagnsiglshhsawltvle

Timeline for d5w59b2:

• d5w59b2 is new in SCOPe 2.06-stable
  
• d5w59b2 appears in SCOPe 2.07
  
• d5w59b2 appears in the current release, SCOPe 2.08