Lineage for d5w59b1 (5w59 B:147-249)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033754Domain d5w59b1: 5w59 B:147-249 [338018]
    Other proteins in same PDB: d5w59a_
    automated match to d3ojvc1
    complexed with so4

Details for d5w59b1

PDB Entry: 5w59 (more details), 2.5 Å

PDB Description: crystal structure of a monomeric human fgf9 in complex with the ectodomain of human fgfr1c
PDB Compounds: (B:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d5w59b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w59b1 b.1.1.0 (B:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggy
kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvve

SCOPe Domain Coordinates for d5w59b1:

Click to download the PDB-style file with coordinates for d5w59b1.
(The format of our PDB-style files is described here.)

Timeline for d5w59b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5w59b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5w59a_