Lineage for d5u51c1 (5u51 C:4-79)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (178 species)
    not a true protein
  7. 2458000Species Francisella tularensis [TaxId:263] [337919] (2 PDB entries)
  8. 2458003Domain d5u51c1: 5u51 C:4-79 [338011]
    Other proteins in same PDB: d5u51c2, d5u51c3, d5u51d2, d5u51d3
    automated match to d1yy7b1
    complexed with 1pe, g4p, gol, mg

Details for d5u51c1

PDB Entry: 5u51 (more details), 2.8 Å

PDB Description: structure of francisella tularensis heterodimeric sspa (mgla-sspa) in complex with ppgpp
PDB Compounds: (C:) stringent starvation protein A

SCOPe Domain Sequences for d5u51c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u51c1 c.47.1.0 (C:4-79) automated matches {Francisella tularensis [TaxId: 263]}
vtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdysinn
rkalliyiderfpaps

SCOPe Domain Coordinates for d5u51c1:

Click to download the PDB-style file with coordinates for d5u51c1.
(The format of our PDB-style files is described here.)

Timeline for d5u51c1: