| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) ![]() |
| Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins) automatically mapped to Pfam PF01470 |
| Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
| Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (3 PDB entries) |
| Domain d1augd_: 1aug D: [33801] |
PDB Entry: 1aug (more details), 2 Å
SCOPe Domain Sequences for d1augd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1augd_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens [TaxId: 1390]}
mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
apslsldhitkalkiaavtaavheddietg
Timeline for d1augd_: