Lineage for d1augc_ (1aug C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497212Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2497213Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
    automatically mapped to Pfam PF01470
  6. 2497214Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 2497215Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (3 PDB entries)
  8. 2497226Domain d1augc_: 1aug C: [33800]

Details for d1augc_

PDB Entry: 1aug (more details), 2 Å

PDB Description: crystal structure of the pyroglutamyl peptidase i from bacillus amyloliquefaciens
PDB Compounds: (C:) pyroglutamyl peptidase-1

SCOPe Domain Sequences for d1augc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1augc_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens [TaxId: 1390]}
mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk
hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik
riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks
apslsldhitkalkiaavtaavheddietg

SCOPe Domain Coordinates for d1augc_:

Click to download the PDB-style file with coordinates for d1augc_.
(The format of our PDB-style files is described here.)

Timeline for d1augc_: