Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) |
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein) |
Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (3 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [53186] (1 PDB entry) |
Domain d1auga_: 1aug A: [33798] |
PDB Entry: 1aug (more details), 2 Å
SCOP Domain Sequences for d1auga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auga_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Bacillus amyloliquefaciens} mekkvlltgfdpfggetvnpsweavkrlngaaegpasivseqvptvfykslavlreaikk hqpdiiicvgqaggrmqitpervainlnearipdnegnqpvgedisqggpaaywtglpik riveeikkegipaavsytagtfvcnhlfyglmdeisrhhphirggfihipyipeqtlqks apslsldhitkalkiaavtaavheddietg
Timeline for d1auga_: