Lineage for d1a2zd_ (1a2z D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124810Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 124930Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) (S)
  5. 124931Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein)
  6. 124932Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (3 species)
  7. 124942Species Archaeon Thermococcus litoralis [TaxId:2265] [53185] (1 PDB entry)
  8. 124946Domain d1a2zd_: 1a2z D: [33797]

Details for d1a2zd_

PDB Entry: 1a2z (more details), 1.73 Å

PDB Description: pyrrolidone carboxyl peptidase from thermococcus litoralis

SCOP Domain Sequences for d1a2zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2zd_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Thermococcus litoralis}
mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
llgkntpsmcleaeikaielavkvsldylekdrddikipl

SCOP Domain Coordinates for d1a2zd_:

Click to download the PDB-style file with coordinates for d1a2zd_.
(The format of our PDB-style files is described here.)

Timeline for d1a2zd_: