Lineage for d1a2zd_ (1a2z D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889399Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2889400Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
    automatically mapped to Pfam PF01470
  6. 2889401Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 2889447Species Thermococcus litoralis [TaxId:2265] [53185] (1 PDB entry)
  8. 2889451Domain d1a2zd_: 1a2z D: [33797]
    complexed with so4

Details for d1a2zd_

PDB Entry: 1a2z (more details), 1.73 Å

PDB Description: pyrrolidone carboxyl peptidase from thermococcus litoralis
PDB Compounds: (D:) pyrrolidone carboxyl peptidase

SCOPe Domain Sequences for d1a2zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2zd_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Thermococcus litoralis [TaxId: 2265]}
mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
llgkntpsmcleaeikaielavkvsldylekdrddikipl

SCOPe Domain Coordinates for d1a2zd_:

Click to download the PDB-style file with coordinates for d1a2zd_.
(The format of our PDB-style files is described here.)

Timeline for d1a2zd_: