![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Culex quinquefasciatus [TaxId:7176] [337959] (1 PDB entry) |
![]() | Domain d5w1ub_: 5w1u B: [337960] automated match to d1qona_ complexed with epe, mli |
PDB Entry: 5w1u (more details), 2.5 Å
SCOPe Domain Sequences for d5w1ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w1ub_ c.69.1.0 (B:) automated matches {Culex quinquefasciatus [TaxId: 7176]} esltvqtkygpvrgkrsvsllgqeyvsfqgipyarapegelrfkapvppqnwtetldcsq qcepcyhfdrrlqkivgcedslkinvfakeinpskplpvmlyiygggftegtsgtelygp dflvqkdivlvsfnyrigalgflccqseqdgvpgnaglkdqnlairwvleniaafggdpk rvtlvghsagaasvqyhlisdaskdlfqraivmsgstynswsltrqrnwveklakaigwd gqggesgalrflkaakpedivanqeklltdqdmqddiftpfgptvepylteqcmipkepf emartawgdkidimiggtseegllllqkiklqpellshphlflgnvppnlkismekrief aaklkqryypdsspsmennlgyvhmmsdrvfwhglhrtilaraarsrartfvyricldse fynhyrimmidpklrgtahadelsylfsnftqqvpgketfeyrglqtlvdvftafvingd pncgmtaksgvvfepnaqtkptfkclniandgvafvdypdadrldmwdamyvndelf
Timeline for d5w1ub_: