Lineage for d1a2zc_ (1a2z C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497212Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2497213Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
    automatically mapped to Pfam PF01470
  6. 2497214Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 2497260Species Thermococcus litoralis [TaxId:2265] [53185] (1 PDB entry)
  8. 2497263Domain d1a2zc_: 1a2z C: [33796]
    complexed with so4

Details for d1a2zc_

PDB Entry: 1a2z (more details), 1.73 Å

PDB Description: pyrrolidone carboxyl peptidase from thermococcus litoralis
PDB Compounds: (C:) pyrrolidone carboxyl peptidase

SCOPe Domain Sequences for d1a2zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2zc_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Thermococcus litoralis [TaxId: 2265]}
mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
llgkntpsmcleaeikaielavkvsldylekdrddikipl

SCOPe Domain Coordinates for d1a2zc_:

Click to download the PDB-style file with coordinates for d1a2zc_.
(The format of our PDB-style files is described here.)

Timeline for d1a2zc_: