Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) |
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein) |
Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
Species Archaeon Thermococcus litoralis [TaxId:2265] [53185] (1 PDB entry) |
Domain d1a2zc_: 1a2z C: [33796] |
PDB Entry: 1a2z (more details), 1.73 Å
SCOP Domain Sequences for d1a2zc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2zc_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Thermococcus litoralis} mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff llgkntpsmcleaeikaielavkvsldylekdrddikipl
Timeline for d1a2zc_: