Lineage for d1a2zc_ (1a2z C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72379Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) (S)
  5. 72380Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein)
  6. 72381Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (3 species)
  7. 72391Species Archaeon Thermococcus litoralis [TaxId:2265] [53185] (1 PDB entry)
  8. 72394Domain d1a2zc_: 1a2z C: [33796]

Details for d1a2zc_

PDB Entry: 1a2z (more details), 1.73 Å

PDB Description: pyrrolidone carboxyl peptidase from thermococcus litoralis

SCOP Domain Sequences for d1a2zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2zc_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Thermococcus litoralis}
mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
llgkntpsmcleaeikaielavkvsldylekdrddikipl

SCOP Domain Coordinates for d1a2zc_:

Click to download the PDB-style file with coordinates for d1a2zc_.
(The format of our PDB-style files is described here.)

Timeline for d1a2zc_: