SCOPe 2.06: Domain d1a2zb_: 1a2z B:

Lineage for d1a2zb_ (1a2z B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families)

5. Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
   automatically mapped to Pfam PF01470

6. Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)

7. Species Thermococcus litoralis [TaxId:2265] [53185] (1 PDB entry)

8. Domain d1a2zb_: 1a2z B: [33795]
   complexed with so4

Details for d1a2zb_

PDB Entry: 1a2z, 1.73 Å

PDB Description: pyrrolidone carboxyl peptidase from thermococcus litoralis

PDB Compounds: (B:) pyrrolidone carboxyl peptidase

SCOPe Domain Sequences for d1a2zb_:

Sequence; same for both SEQRES and ATOM records:

>d1a2zb_ c.56.4.1 (B:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Thermococcus litoralis [TaxId: 2265]}
mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
llgkntpsmcleaeikaielavkvsldylekdrddikipl

Timeline for d1a2zb_:

• d1a2zb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a2zb_ appears in SCOPe 2.05
  
• d1a2zb_ appears in SCOPe 2.07
  
• d1a2zb_ appears in the current release, SCOPe 2.08