![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) ![]() |
![]() | Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins) automatically mapped to Pfam PF01470 |
![]() | Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
![]() | Species Thermococcus litoralis [TaxId:2265] [53185] (1 PDB entry) |
![]() | Domain d1a2zb_: 1a2z B: [33795] complexed with so4 |
PDB Entry: 1a2z (more details), 1.73 Å
SCOPe Domain Sequences for d1a2zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2zb_ c.56.4.1 (B:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Thermococcus litoralis [TaxId: 2265]} mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff llgkntpsmcleaeikaielavkvsldylekdrddikipl
Timeline for d1a2zb_: