Lineage for d5lpla1 (5lpl A:1081-1197)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706696Protein CREB-binding protein, CBP [74712] (2 species)
  7. 2706697Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)
  8. 2706749Domain d5lpla1: 5lpl A:1081-1197 [337942]
    Other proteins in same PDB: d5lpla2
    automated match to d4nyva_
    complexed with 71x

Details for d5lpla1

PDB Entry: 5lpl (more details), 1.65 Å

PDB Description: crystal structure of the bromodomain of human crebbp bound to the inhibitor xdm3c
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5lpla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lpla1 a.29.2.1 (A:1081-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d5lpla1:

Click to download the PDB-style file with coordinates for d5lpla1.
(The format of our PDB-style files is described here.)

Timeline for d5lpla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lpla2