Lineage for d1a2za_ (1a2z A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) 
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein) Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) Species Archaeon Thermococcus litoralis [TaxId:2265] [53185] (1 PDB entry) 
Domain d1a2za_: 1a2z A: [33794]
Details for d1a2za_
PDB Entry: 1a2z (more details), 1.73 Å
PDB Description: pyrrolidone carboxyl peptidase from thermococcus litoralis
SCOP Domain Sequences for d1a2za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2za_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Thermococcus litoralis}
mkkvlitgfepfggdsknpteqiakyfdrkqignamvygrvlpvsvkratielkryleei
kpeivinlglaptysnitveriavniidaripdndgyqpidekieedaplaymatlpvra
itktlrdngipatisysagtylcnyvmfktlhfskiegyplkagfihvpytpdqvvnkff
llgkntpsmcleaeikaielavkvsldylekdrddikipl
SCOP Domain Coordinates for d1a2za_:
Click to download the PDB-style file with coordinates for d1a2za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a2za_:
- d1a2za_ first appeared (with stable ids) in SCOP 1.55
- d1a2za_ appears in SCOP 1.59
- d1a2za_ appears in SCOP 1.63
- d1a2za_ appears in the current release, SCOPe 2.08
View in 3D
