SCOPe 2.08: Domain d5vj0d1: 5vj0 D:1-299

Lineage for d5vj0d1 (5vj0 D:1-299)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Enterobacter lignolyticus [TaxId:1334193] [337933] (1 PDB entry)

8. Domain d5vj0d1: 5vj0 D:1-299 [337939]
   Other proteins in same PDB: d5vj0d2
   automated match to d2iiza_
   complexed with hem

Details for d5vj0d1

PDB Entry: 5vj0, 1.93 Å

PDB Description: crystal structure of heme-containing dyp type peroxidase from enterobacter lignolyticus

PDB Compounds: (D:) Dyp-type peroxidase family

SCOPe Domain Sequences for d5vj0d1:

Sequence; same for both SEQRES and ATOM records:

>d5vj0d1 d.58.4.0 (D:1-299) automated matches {Enterobacter lignolyticus [TaxId: 1334193]}
msqvqsgilpehcraaiwieanvkgdvnalrecskvfadklagfeaqfpdahlgavvafg
hdtwralsggvgaeelkdftpygkglapatqydvlihilslrhdvnfsvaqaamaafgda
vevkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnl
kqlnrmsvhdqemmigrtkvaneeidgderpetshltrvdlkengkglkivrqslpygta
sgthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsldkllal

Timeline for d5vj0d1:

• d5vj0d1 first appeared in SCOPe 2.06
  
• d5vj0d1 appears in SCOPe 2.07