Lineage for d5uv5a2 (5uv5 A:430-553)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887354Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (22 PDB entries)
  8. 2887377Domain d5uv5a2: 5uv5 A:430-553 [337936]
    Other proteins in same PDB: d5uv5a1, d5uv5b1, d5uv5b2, d5uv5c1, d5uv5d_
    automated match to d1dloa1
    complexed with mn, y55

Details for d5uv5a2

PDB Entry: 5uv5 (more details), 3 Å

PDB Description: crystal structure of a 2-hydroxyisoquinoline-1,3-dione rnase h active site inhibitor with multiple binding modes to hiv reverse transcriptase
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d5uv5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uv5a2 c.55.3.0 (A:430-553) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvs

SCOPe Domain Coordinates for d5uv5a2:

Click to download the PDB-style file with coordinates for d5uv5a2.
(The format of our PDB-style files is described here.)

Timeline for d5uv5a2: