SCOPe 2.06: Domain d5vj0b_: 5vj0 B:

Lineage for d5vj0b_ (5vj0 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (27 species)
   not a true protein

7. Species Enterobacter lignolyticus [TaxId:1334193] [337933] (1 PDB entry)

8. Domain d5vj0b_: 5vj0 B: [337934]
   Other proteins in same PDB: d5vj0d2
   automated match to d2iiza_
   complexed with hem

Details for d5vj0b_

PDB Entry: 5vj0, 1.93 Å

PDB Description: crystal structure of heme-containing dyp type peroxidase from enterobacter lignolyticus

PDB Compounds: (B:) Dyp-type peroxidase family

SCOPe Domain Sequences for d5vj0b_:

Sequence; same for both SEQRES and ATOM records:

>d5vj0b_ d.58.4.0 (B:) automated matches {Enterobacter lignolyticus [TaxId: 1334193]}
sqvqsgilpehcraaiwieanvkgdvnalrecskvfadklagfeaqfpdahlgavvafgh
dtwralsggvgaeelkdftpygkglapatqydvlihilslrhdvnfsvaqaamaafgdav
evkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlk
qlnrmsvhdqemmigrtkvaneeidgderpetshltrvdlkengkglkivrqslpygtas
gthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsldkllal

Timeline for d5vj0b_:

• d5vj0b_ is new in SCOPe 2.06-stable
  
• d5vj0b_ appears in SCOPe 2.07
  
• d5vj0b_ appears in the current release, SCOPe 2.08