Lineage for d5vj0b_ (5vj0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950256Species Enterobacter lignolyticus [TaxId:1334193] [337933] (1 PDB entry)
  8. 2950258Domain d5vj0b_: 5vj0 B: [337934]
    Other proteins in same PDB: d5vj0d2
    automated match to d2iiza_
    complexed with hem

Details for d5vj0b_

PDB Entry: 5vj0 (more details), 1.93 Å

PDB Description: crystal structure of heme-containing dyp type peroxidase from enterobacter lignolyticus
PDB Compounds: (B:) Dyp-type peroxidase family

SCOPe Domain Sequences for d5vj0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vj0b_ d.58.4.0 (B:) automated matches {Enterobacter lignolyticus [TaxId: 1334193]}
sqvqsgilpehcraaiwieanvkgdvnalrecskvfadklagfeaqfpdahlgavvafgh
dtwralsggvgaeelkdftpygkglapatqydvlihilslrhdvnfsvaqaamaafgdav
evkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlk
qlnrmsvhdqemmigrtkvaneeidgderpetshltrvdlkengkglkivrqslpygtas
gthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsldkllal

SCOPe Domain Coordinates for d5vj0b_:

Click to download the PDB-style file with coordinates for d5vj0b_.
(The format of our PDB-style files is described here.)

Timeline for d5vj0b_: