Lineage for d5u51d2 (5u51 D:80-194)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2322923Species Francisella tularensis [TaxId:263] [337921] (2 PDB entries)
  8. 2322927Domain d5u51d2: 5u51 D:80-194 [337932]
    Other proteins in same PDB: d5u51c1, d5u51c3, d5u51d1, d5u51d3
    automated match to d1yy7b2
    complexed with 1pe, g4p, gol, mg

Details for d5u51d2

PDB Entry: 5u51 (more details), 2.8 Å

PDB Description: structure of francisella tularensis heterodimeric sspa (mgla-sspa) in complex with ppgpp
PDB Compounds: (D:) stringent starvation protein A

SCOPe Domain Sequences for d5u51d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u51d2 a.45.1.0 (D:80-194) automated matches {Francisella tularensis [TaxId: 263]}
llpnvvnerikirlsldkidnewypvldqirkhrsdqkmlesmfkdlkesllamekaftg
seffissgftladcyiaaliicleaegfiiddeygaiyeykkrlfardsvkkani

SCOPe Domain Coordinates for d5u51d2:

Click to download the PDB-style file with coordinates for d5u51d2.
(The format of our PDB-style files is described here.)

Timeline for d5u51d2: