SCOPe 2.08: Domain d5u56d1: 5u56 D:4-79

Lineage for d5u56d1 (5u56 D:4-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Francisella tularensis [TaxId:263] [337919] (2 PDB entries)

8. Domain d5u56d1: 5u56 D:4-79 [337924]
   Other proteins in same PDB: d5u56c2, d5u56c3, d5u56d2, d5u56d3
   automated match to d1yy7b1
   complexed with 1pe, gol, pro

Details for d5u56d1

PDB Entry: 5u56, 2.65 Å

PDB Description: structure of francisella tularensis heterodimeric sspa (mgla-sspa)

PDB Compounds: (D:) stringent starvation protein A

SCOPe Domain Sequences for d5u56d1:

Sequence; same for both SEQRES and ATOM records:

>d5u56d1 c.47.1.0 (D:4-79) automated matches {Francisella tularensis [TaxId: 263]}
vtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdysinn
rkalliyiderfpaps

Timeline for d5u56d1:

• d5u56d1 first appeared in SCOPe 2.06
  
• d5u56d1 appears in SCOPe 2.07