Lineage for d5u56c2 (5u56 C:80-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2322923Species Francisella tularensis [TaxId:263] [337921] (2 PDB entries)
  8. 2322924Domain d5u56c2: 5u56 C:80-195 [337922]
    Other proteins in same PDB: d5u56c1, d5u56c3, d5u56d1, d5u56d3
    automated match to d1yy7b2
    complexed with 1pe, gol, pro

Details for d5u56c2

PDB Entry: 5u56 (more details), 2.65 Å

PDB Description: structure of francisella tularensis heterodimeric sspa (mgla-sspa)
PDB Compounds: (C:) stringent starvation protein A

SCOPe Domain Sequences for d5u56c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u56c2 a.45.1.0 (C:80-195) automated matches {Francisella tularensis [TaxId: 263]}
llpnvvnerikirlsldkidnewypvldqirkhrsdqkmlesmfkdlkesllamekaftg
seffissgftladcyiaaliicleaegfiiddeygaiyeykkrlfardsvkkanik

SCOPe Domain Coordinates for d5u56c2:

Click to download the PDB-style file with coordinates for d5u56c2.
(The format of our PDB-style files is described here.)

Timeline for d5u56c2: