Lineage for d5n69h_ (5n69 H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1997730Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1997731Protein automated matches [190513] (30 species)
    not a true protein
  7. 1997749Species Cow (Bos taurus) [TaxId:9913] [311228] (2 PDB entries)
  8. 1997751Domain d5n69h_: 5n69 H: [337915]
    automated match to d3i5fc_
    complexed with 2ow, adp, gol, mg, tce, vo4

Details for d5n69h_

PDB Entry: 5n69 (more details), 2.45 Å

PDB Description: cardiac muscle myosin s1 fragment in the pre-powerstroke state co- crystallized with the activator omecamtiv mecarbil
PDB Compounds: (H:) Myosin light chain 3

SCOPe Domain Sequences for d5n69h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n69h_ a.39.1.0 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pefdpskikieftpeqieefkeaftlfdrtpkcemkitygqcgdvlralgqnptqaevlr
vlgkpkqeelnskmmdfdtflpmlqhisknkdtgtyedfveglrvfdkegngtvmgaelr
hvlatlgekltedeveklmagqedsngcinyeafvkhimag

SCOPe Domain Coordinates for d5n69h_:

Click to download the PDB-style file with coordinates for d5n69h_.
(The format of our PDB-style files is described here.)

Timeline for d5n69h_: