Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [311228] (3 PDB entries) |
Domain d5n69h_: 5n69 H: [337915] automated match to d3i5fc_ complexed with 2ow, adp, gol, mg, tce, vo4 |
PDB Entry: 5n69 (more details), 2.45 Å
SCOPe Domain Sequences for d5n69h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n69h_ a.39.1.0 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} pefdpskikieftpeqieefkeaftlfdrtpkcemkitygqcgdvlralgqnptqaevlr vlgkpkqeelnskmmdfdtflpmlqhisknkdtgtyedfveglrvfdkegngtvmgaelr hvlatlgekltedeveklmagqedsngcinyeafvkhimag
Timeline for d5n69h_: