Lineage for d1cg6a_ (1cg6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125405Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 2125406Species Human (Homo sapiens) [TaxId:9606] [53175] (13 PDB entries)
    Uniprot Q13126
  8. 2125408Domain d1cg6a_: 1cg6 A: [33791]
    complexed with mta, so4

Details for d1cg6a_

PDB Entry: 1cg6 (more details), 1.7 Å

PDB Description: structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-deoxy-5'-methylthioadenosine and sulfate at 1.7 a resolution
PDB Compounds: (A:) protein (5'-deoxy-5'-methylthioadenosine phosphorylase)

SCOPe Domain Sequences for d1cg6a_:

Sequence, based on SEQRES records: (download)

>d1cg6a_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
wgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktlkenankak
slllttipqigstewsetlhnlknmaqfsvllp

Sequence, based on observed residues (ATOM records): (download)

>d1cg6a_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
wgadvinmttvpevvlakeagicyasiamatdydcwavsvdrvlktlkenankakslllt
tipqigstewsetlhnlknmaqfsvllp

SCOPe Domain Coordinates for d1cg6a_:

Click to download the PDB-style file with coordinates for d1cg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1cg6a_: