Lineage for d5lkwa_ (5lkw A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2202325Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2202351Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2202352Protein automated matches [195455] (11 species)
    not a true protein
  7. 2202400Species Burkholderia cenocepacia [TaxId:216591] [336981] (2 PDB entries)
  8. 2202404Domain d5lkwa_: 5lkw A: [337908]
    automated match to d4b5cb_
    complexed with api

Details for d5lkwa_

PDB Entry: 5lkw (more details), 2 Å

PDB Description: crystal structure of the peptidoglycan-associated lipoprotein (pal) from burkholderia cepacia in complex with dap
PDB Compounds: (A:) putative ompa family lipoprotein

SCOPe Domain Sequences for d5lkwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lkwa_ d.79.7.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
dplndpnsplakrsiyfdfdsysvkdeyqplmqqhaqylkshpqrhvliqgntdergtse
ynlalgqkraeavrramallgvndsqmeavslgkekpqatghdeaswaqnrradlvyqq

SCOPe Domain Coordinates for d5lkwa_:

Click to download the PDB-style file with coordinates for d5lkwa_.
(The format of our PDB-style files is described here.)

Timeline for d5lkwa_: